DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:66 Identity:31/66 - (46%)
Similarity:38/66 - (57%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.....|.|..:||.||..| |.|||...||.|:....:|..|||||||||.|:|||:..|.:.|
Mouse    82 ACGRKCLDLSEDICSLPQDA-GPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 145

  Fly    77 V 77
            :
Mouse   146 I 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 26/50 (52%)
Wfdc6bXP_006499938.1 WAP <63..89 CDD:459672 1/6 (17%)
Kunitz_eppin 93..149 CDD:438654 28/55 (51%)

Return to query results.
Submit another query.