DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG17380

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster


Alignment Length:76 Identity:31/76 - (40%)
Similarity:42/76 - (55%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENS 65
            |..|....:|:.:...|.||::|.|.. .|..|.|...|..::||...|||..||||||.||.|.
  Fly     1 MNSLHYFLIFLIVPGTSTALRHERCSF-IANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNR 64

  Fly    66 FESQEECINKC 76
            |::::|||..|
  Fly    65 FQTKKECILLC 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 23/50 (46%)
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 23/50 (46%)

Return to query results.
Submit another query.