DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG42827

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:92 Identity:27/92 - (29%)
Similarity:43/92 - (46%) Gaps:17/92 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLIL-------LFVFIALASNSLA---------LKNEICGLPAAANGNCLALFSRWSYDAQYN 49
            |:|.||       :.:.|.:.|:||.         ::.:|| |.::..|.|......|.|:.:.:
  Fly     1 MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKIC-LQSSEYGKCKGRRKLWFYNPKKS 64

  Fly    50 VCFNFIYGGCQGNENSFESQEECINKC 76
            .|..|||..|.||.|.|.::|.|:..|
  Fly    65 KCQVFIYSNCGGNGNLFYTKESCVEFC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 17/50 (34%)
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 17/50 (34%)

Return to query results.
Submit another query.