DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG14298

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:37 Identity:18/37 - (48%)
Similarity:21/37 - (56%) Gaps:2/37 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            :||.:|.  .||..|.|.||.||.|.|.|||.|..:|
  Fly    75 TRWYFDK--GVCKPFNYKGCNGNRNRFCSQESCDARC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 17/35 (49%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 17/35 (49%)

Return to query results.
Submit another query.