DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG34276

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster


Alignment Length:76 Identity:21/76 - (27%)
Similarity:32/76 - (42%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSF 66
            |:..||.:.:.....|.::|.. |..|... |...|....|.|::....|..||:.|...|.|:|
  Fly     4 KISCLLILLVFCLQQSYSIKRR-CLQPLDV-GKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNF 66

  Fly    67 ESQEECINKCV 77
            .:|..|...|:
  Fly    67 NTQARCHKICL 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 15/50 (30%)
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 15/50 (30%)

Return to query results.
Submit another query.