DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_063140392.1 Gene:Wfdc6b / 408225 RGDID:1303277 Length:192 Species:Rattus norvegicus


Alignment Length:65 Identity:31/65 - (47%)
Similarity:39/65 - (60%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.....|.|..:||.||..| |.|||...||.|:.:.|:|..|||||||||.|:|.|::.|.:.|
  Rat    74 ACGKKCLDLNEDICSLPQDA-GPCLAYLPRWWYNKKTNLCTQFIYGGCQGNTNNFLSKDICTSIC 137

  Fly    77  76
              Rat   138  137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 26/50 (52%)
Wfdc6bXP_063140392.1 None

Return to query results.
Submit another query.