DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and spint1a

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:44 Identity:17/44 - (38%)
Similarity:27/44 - (61%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.|....::|.|:....:|:.|.||||:||:|.||::..|:..|
Zfish   392 GTCPGSQTKWYYNPNKRLCYRFNYGGCEGNQNRFETEAGCMTFC 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 16/42 (38%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.