DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG3604

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster


Alignment Length:47 Identity:15/47 - (31%)
Similarity:19/47 - (40%) Gaps:12/47 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 IAKAFWVRRKPIGVPSGTNKCTATSTSGESGSDRKATLTTNVATLQP 308
            :||.:.:|   |.||         ||.|..|.|.....|.||...:|
  Fly   147 LAKQYKMR---IFVP---------STIGAFGPDSPRNPTPNVTIQRP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.