DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG16713

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:82 Identity:47/82 - (57%)
Similarity:57/82 - (69%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANG----NCLALFSRWSYDAQYNVCFNFIYGGCQG 61
            ||||||:|||:|..:|:|||||.|||||.:.||    :|.|....|||||..|.|..||||||.|
  Fly     1 MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGG 65

  Fly    62 NENSFESQEECINKCVE 78
            |.|.|.|:|.|.:||::
  Fly    66 NNNRFNSREICEDKCLQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 28/54 (52%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 29/55 (53%)

Return to query results.
Submit another query.