DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG16713

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:82 Identity:47/82 - (57%)
Similarity:57/82 - (69%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANG----NCLALFSRWSYDAQYNVCFNFIYGGCQG 61
            ||||||:|||:|..:|:|||||.|||||.:.||    :|.|....|||||..|.|..||||||.|
  Fly     1 MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGG 65

  Fly    62 NENSFESQEECINKCVE 78
            |.|.|.|:|.|.:||::
  Fly    66 NNNRFNSREICEDKCLQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 30/56 (54%)
CG16713NP_608799.1 KU 23..81 CDD:238057 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 1 1.000 - - mtm8563
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
76.790

Return to query results.
Submit another query.