DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG3513

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster


Alignment Length:81 Identity:30/81 - (37%)
Similarity:41/81 - (50%) Gaps:14/81 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FIALA-----SNS---LALKNEICGLPAAANG------NCLALFSRWSYDAQYNVCFNFIYGGCQ 60
            |:|:|     |.|   :..|.|:|..|::..|      .|:|....|:|||..|.|..||:|||.
  Fly     6 FVAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCG 70

  Fly    61 GNENSFESQEECINKC 76
            ||.|.|.::.||...|
  Fly    71 GNSNQFSTKSECEKAC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 23/59 (39%)
CG3513NP_608798.1 KU 29..87 CDD:238057 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
54.860

Return to query results.
Submit another query.