DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and LOC3292058

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_553610.4 Gene:LOC3292058 / 3292058 VectorBaseID:AGAMI1_012805 Length:155 Species:Anopheles gambiae


Alignment Length:59 Identity:24/59 - (40%)
Similarity:33/59 - (55%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            :|.::|.|.|| ...|.|.||..|:.||.....|..|.:|||.||.|:|.|.::|:..|
Mosquito    95 VAGRDEQCKLP-PRRGVCRALLPRFRYDPAQKECIEFKFGGCDGNANNFMSYKQCMEAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 21/50 (42%)
LOC3292058XP_553610.4 None

Return to query results.
Submit another query.