DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and tfpil

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001373281.1 Gene:tfpil / 322379 ZFINID:ZDB-GENE-030131-1098 Length:211 Species:Danio rerio


Alignment Length:57 Identity:25/57 - (43%)
Similarity:34/57 - (59%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            :..||.: ....|.|.|||..:.|:|:..:|..|||.||:||.|.|||:|||...|:
Zfish    89 ETSICSM-EMDEGTCFALFPMYYYNAEEKICRMFIYRGCRGNANRFESREECQQTCL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 23/50 (46%)
tfpilNP_001373281.1 Kunitz_conkunitzin 27..77 CDD:438636
Kunitz-type 93..143 CDD:438633 23/50 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.