DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG31609

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:73 Identity:26/73 - (35%)
Similarity:34/73 - (46%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFES 68
            |:.|:..:|:......:|...|.. .|..|.|......|.||...|.|..|.||||.||.|.|.:
  Fly    10 LLFLYPVVAVVPQGFTIKQPKCWY-VANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYT 73

  Fly    69 QEECINKC 76
            :|||:..|
  Fly    74 KEECLKTC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 21/50 (42%)
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/50 (42%)

Return to query results.
Submit another query.