| Sequence 1: | NP_001036330.1 | Gene: | Acp24A4 / 318936 | FlyBaseID: | FBgn0051779 | Length: | 78 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001004265.2 | Gene: | Spint1 / 311331 | RGDID: | 1303138 | Length: | 507 | Species: | Rattus norvegicus |
| Alignment Length: | 44 | Identity: | 19/44 - (43%) |
|---|---|---|---|
| Similarity: | 28/44 - (63%) | Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 33 GNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Acp24A4 | NP_001036330.1 | Kunitz-type | 25..76 | CDD:438633 | 18/42 (43%) |
| Spint1 | NP_001004265.2 | MANEC | 42..133 | CDD:462186 | |
| Kunitz_HAI1_1-like | 239..297 | CDD:438666 | 19/44 (43%) | ||
| LDLa | 313..344 | CDD:197566 | |||
| Kunitz_HAI1_2-like | 369..428 | CDD:438667 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||