DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Tfpi

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi / 29436 RGDID:61914 Length:306 Species:Rattus norvegicus


Alignment Length:64 Identity:26/64 - (40%)
Similarity:34/64 - (53%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            :.:.|.|.|.:.|.|.... |.|....:|:.|:.|...|..|.||||.||.|:||:.|||.|.|
  Rat   112 IKTTSGAEKPDFCFLEEDP-GICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 22/50 (44%)
TfpiXP_008760202.1 Kunitz_TFPI1_1-like 50..104 CDD:438656
Kunitz_TFPI1_2-like 120..175 CDD:438657 24/56 (43%)
Kunitz_TFPI1_TFPI2_3-like 223..276 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.