DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Spint2

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001076018.1 Gene:Spint2 / 292770 RGDID:735123 Length:250 Species:Rattus norvegicus


Alignment Length:54 Identity:29/54 - (53%)
Similarity:36/54 - (66%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.| :|.|..|.|.|.|.||.||.:.|.|.:||||||:||:||:.|||.|:..|
  Rat   129 EYC-VPKAVTGPCRAAFPRWYYDVEKNSCSSFIYGGCRGNKNSYLSQEACMQHC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 27/50 (54%)
Spint2NP_001076018.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 129..181 CDD:438665 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.