DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp24A4 and Spint2

DIOPT Version :9

Sequence 1:	NP_001036330.1	Gene:	Acp24A4 / 318936	FlyBaseID:	FBgn0051779	Length:	78	Species:	Drosophila melanogaster
Sequence 2:	NP_001076018.1	Gene:	Spint2 / 292770	RGDID:	735123	Length:	250	Species:	Rattus norvegicus

Alignment Length:	54	Identity:	29/54 - (53%)
Similarity:	36/54 - (66%)	Gaps:	1/54 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.| :|.|..|.|.|.|.||.||.:.|.|.:||||||:||:||:.|||.|:..|
  Rat   129 EYC-VPKAVTGPCRAAFPRWYYDVEKNSCSSFIYGGCRGNKNSYLSQEACMQHC 181

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp24A4	NP_001036330.1	Kunitz_BPTI	24..77	CDD:278443	28/53 (53%)
Spint2	NP_001076018.1	Kunitz_BPTI	38..88	CDD:278443
Spint2	NP_001076018.1	Kunitz_BPTI	130..181	CDD:278443	27/51 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	67	1.000	Domainoid score	I9614
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.810