DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Tfpi2

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_775164.2 Gene:Tfpi2 / 286926 RGDID:628629 Length:230 Species:Rattus norvegicus


Alignment Length:74 Identity:31/74 - (41%)
Similarity:40/74 - (54%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILLFVFIALASNSLALKN-EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFE 67
            |:|:...:.|||.|....| |||.||... |.|.||..::.||.....|..|.||||.||.|:|.
  Rat    14 LLLVGSALGLASVSAQGNNLEICLLPLDM-GPCKALIPKFYYDRDQKKCRRFKYGGCLGNANNFH 77

  Fly    68 SQEECINKC 76
            |::.|.:.|
  Rat    78 SRKLCEHTC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 21/50 (42%)
Tfpi2NP_775164.2 Kunitz-type 32..87 CDD:444694 25/56 (45%)
Kunitz-type 93..146 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 153..206 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.