DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp24A4 and Ambp

DIOPT Version :9

Sequence 1:	NP_001036330.1	Gene:	Acp24A4 / 318936	FlyBaseID:	FBgn0051779	Length:	78	Species:	Drosophila melanogaster
Sequence 2:	XP_008761981.1	Gene:	Ambp / 25377	RGDID:	2102	Length:	361	Species:	Rattus norvegicus

Alignment Length:	52	Identity:	24/52 - (46%)
Similarity:	29/52 - (55%)	Gaps:	1/52 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 CGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.|| ...|.|.|....|::||....|..||||||:||.|.|.|::||...|
  Rat   286 CNLP-IVQGPCRAFAELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYC 336

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp24A4	NP_001036330.1	Kunitz_BPTI	24..77	CDD:278443	24/52 (46%)
Ambp	XP_008761981.1	Lipocalin	41..185	CDD:278490
		Kunitz_BPTI	230..281	CDD:278443
		Kunitz_BPTI	285..337	CDD:278443	24/52 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810