DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Tfpi2

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001368837.1 Gene:Tfpi2 / 21789 MGIID:108543 Length:266 Species:Mus musculus


Alignment Length:74 Identity:31/74 - (41%)
Similarity:39/74 - (52%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILLFVFIALASNSLALKN-EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFE 67
            |:|:...:.|.|.|....| |||.||..| |.|.||..::.||.....|..|.||||.||.|:|.
Mouse    50 LLLVGSVLGLTSVSAQGNNLEICLLPLDA-GPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFH 113

  Fly    68 SQEECINKC 76
            |::.|...|
Mouse   114 SRDLCQQTC 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 22/50 (44%)
Tfpi2NP_001368837.1 Kunitz_TFPI2_1-like 68..124 CDD:438659 26/56 (46%)
Kunitz-type 129..182 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 189..242 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.