DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp24A4 and Tfpi

DIOPT Version :9

Sequence 1:	NP_001036330.1	Gene:	Acp24A4 / 318936	FlyBaseID:	FBgn0051779	Length:	78	Species:	Drosophila melanogaster
Sequence 2:	NP_001342200.1	Gene:	Tfpi / 21788	MGIID:	1095418	Length:	306	Species:	Mus musculus

Alignment Length:	48	Identity:	20/48 - (41%)
Similarity:	30/48 - (62%)	Gaps:	0/48 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 AANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            |.:|.|.|:...:.::...:.|..||||||:||||.|::.|||...|:
Mouse    54 ADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCI 101

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp24A4	NP_001036330.1	Kunitz_BPTI	24..77	CDD:278443	19/46 (41%)
Tfpi	NP_001342200.1	KU	48..101	CDD:238057	19/46 (41%)
		Kunitz_BPTI	120..171	CDD:394972
		Kunitz_BPTI	224..276	CDD:394972
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.810