DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Col28a1

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:66 Identity:24/66 - (36%)
Similarity:31/66 - (46%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            |.|.....|:..|. .|...|.|.....||.||.|.|.|..|.:.||.|:.|.|.|::||...|:
Mouse  1076 LQSEKSLYKDPRCE-EALKPGECGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECRETCI 1139

  Fly    78 E 78
            :
Mouse  1140 K 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 20/50 (40%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 20/50 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.