DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp24A4 and Wfdc6a

DIOPT Version :9

Sequence 1:	NP_001036330.1	Gene:	Acp24A4 / 318936	FlyBaseID:	FBgn0051779	Length:	78	Species:	Drosophila melanogaster
Sequence 2:	XP_011237710.1	Gene:	Wfdc6a / 209351	MGIID:	2684968	Length:	193	Species:	Mus musculus

Alignment Length:	57	Identity:	26/57 - (45%)
Similarity:	35/57 - (61%)	Gaps:	1/57 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    20 LKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |:.::|.||... |.|||...||.|:.:.::|..|||||||||.|:|.|:..|...|
Mouse   129 LRQDVCSLPQDP-GPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVC 184

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp24A4	NP_001036330.1	Kunitz_BPTI	24..77	CDD:278443	25/53 (47%)
Wfdc6a	XP_011237710.1	WAP	89..128	CDD:365870
Wfdc6a	XP_011237710.1	Kunitz_BPTI	133..184	CDD:333766	24/51 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	59	1.000	Inparanoid score	I5407
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1474897at2759
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	6	5.870