DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Spint1

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_058603.2 Gene:Spint1 / 20732 MGIID:1338033 Length:507 Species:Mus musculus


Alignment Length:44 Identity:19/44 - (43%)
Similarity:28/44 - (63%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.|...|.||.||.:..:|.:|.:|||.||:|::..:|||:..|
Mouse   251 GRCRGSFPRWYYDPKEQICKSFTFGGCLGNKNNYLREEECMLAC 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 18/42 (43%)
Spint1NP_058603.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666 19/44 (43%)
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.