DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp24A4 and T22F7.3

DIOPT Version :9

Sequence 1:	NP_001036330.1	Gene:	Acp24A4 / 318936	FlyBaseID:	FBgn0051779	Length:	78	Species:	Drosophila melanogaster
Sequence 2:	NP_497207.4	Gene:	T22F7.3 / 188757	WormBaseID:	WBGene00020702	Length:	1517	Species:	Caenorhabditis elegans

Alignment Length:	71	Identity:	23/71 - (32%)
Similarity:	36/71 - (50%)	Gaps:	9/71 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 ASNSLALKNEICGLPAAAN--------GNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQE 70
            :|:|....:::| .|.|.:        |:|.:...|:.|:|....|..|.|.|||||:|:|.:..
Worm   514 SSHSCQGSHKVC-CPTAQSLCTQPKRLGDCTSAVRRYWYNAATRSCEMFQYTGCQGNDNNFNTLM 577

  Fly    71 ECINKC 76
            .|..||
Worm   578 ACQQKC 583

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp24A4	NP_001036330.1	Kunitz_BPTI	24..77	CDD:278443	21/61 (34%)
T22F7.3	NP_497207.4	EB	144..199	CDD:396311
		KU	311..365	CDD:197529
		KU	<450..486	CDD:197529
		Kunitz_BPTI	533..584	CDD:394972	18/51 (35%)
		Kunitz_BPTI	639..693	CDD:394972
		Kunitz_BPTI	747..800	CDD:394972
		Lustrin_cystein	1077..1118	CDD:405330
		EB	1218..1269	CDD:396311
		EB	1295..1346	CDD:396311
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810