DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and piit-1

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_505943.2 Gene:piit-1 / 185259 WormBaseID:WBGene00009384 Length:200 Species:Caenorhabditis elegans


Alignment Length:77 Identity:24/77 - (31%)
Similarity:36/77 - (46%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLILLFVFIALASNSLALKNEICGLPAAANGNCLALFS---RWSYDAQYNVCFNFIYGGCQGNEN 64
            :.:.|.|.::|.|.:.|....:....|..:||..|..|   .:.|..:...|..|:|.||.||.|
 Worm     1 MALRLAVILSLLSFTAAQSTSVDCFAARDSGNTCAENSSSRMFYYLPRLGTCQPFMYQGCGGNSN 65

  Fly    65 SFESQEECINKC 76
            .|.|.:||.:.|
 Worm    66 RFSSAQECRSAC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 18/53 (34%)
piit-1NP_505943.2 Kunitz_BPTI 24..77 CDD:425421 18/52 (35%)
KU 137..192 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.