DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and C54D10.10

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:75 Identity:24/75 - (32%)
Similarity:37/75 - (49%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILLFVFIALASNSLALKNEICGLPAAANGNC--LALFSRWSYDAQYNVCFNFIYGGCQGNENSFE 67
            |.:|:.:...|:..|:.   |........||  ..:..::.:|.:.|||....|.||.||||.||
 Worm     4 ISIFLLLCCISSVSAIN---CRQEKDTGVNCDNKPITLKFYFDMRTNVCQPLFYRGCGGNENRFE 65

  Fly    68 SQEECINKCV 77
            |::.|.:.||
 Worm    66 SRDACSDACV 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 18/52 (35%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421 18/53 (34%)
KU 158..213 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.