DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and mlt-11

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001256938.1 Gene:mlt-11 / 180352 WormBaseID:WBGene00012186 Length:3129 Species:Caenorhabditis elegans


Alignment Length:45 Identity:23/45 - (51%)
Similarity:31/45 - (68%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            |.|..:|||:::|...|.|.:|.||||.||.|:|.:.:||.||||
 Worm   873 GECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKCV 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 20/42 (48%)
mlt-11NP_001256938.1 TY <361..409 CDD:238114
Kunitz-type 429..473 CDD:438633
Kunitz_BPTI 538..590 CDD:425421
Kunitz-type 737..787 CDD:438633
Kunitz_BPTI 803..855 CDD:425421
Kunitz_BPTI 865..917 CDD:425421 21/43 (49%)
Kunitz-type 1083..1133 CDD:438633
Kunitz_BPTI 2176..2228 CDD:425421
Kunitz_ixolaris_2 2241..2291 CDD:438669
Kunitz_BPTI 2742..2793 CDD:425421
Lustrin_cystein 2910..2956 CDD:464222
Kunitz_BPTI 3070..3128 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.