DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG43165

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster


Alignment Length:80 Identity:37/80 - (46%)
Similarity:49/80 - (61%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANGN----CLALFSRWSYDAQYNVCFNFIYGGCQG 61
            |:|::|..:.:||.:..|.||:.|||.|.|.|||    |...|.::||....|||..|.||||.|
  Fly     1 MRLVVLGCLLLALETVGLCLKDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFG 65

  Fly    62 NENSFESQEECINKC 76
            |:|||.:.|:|..||
  Fly    66 NDNSFNTLEKCHKKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 29/57 (51%)
CG43165NP_001245858.1 KU 24..81 CDD:294074 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 1 1.000 - - mtm8563
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
65.860

Return to query results.
Submit another query.