DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and WFIKKN2

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_783165.1 Gene:WFIKKN2 / 124857 HGNCID:30916 Length:576 Species:Homo sapiens


Alignment Length:66 Identity:30/66 - (45%)
Similarity:39/66 - (59%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINK 75
            :|..|..||    .|.|| |..|.|.|...||:|::|...|.:|:||||:||.|:|||:|.|...
Human   376 LACMSGPLA----ACSLP-ALQGPCKAYAPRWAYNSQTGQCQSFVYGGCEGNGNNFESREACEES 435

  Fly    76 C 76
            |
Human   436 C 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 26/53 (49%)
WFIKKN2NP_783165.1 WAP 44..90 CDD:278522
KAZAL_FS 138..174 CDD:238052
I-set 216..304 CDD:254352
Ig_3 224..304 CDD:143242
Kunitz_BPTI 328..379 CDD:278443 1/2 (50%)
Kunitz_BPTI 385..436 CDD:278443 25/51 (49%)
NTR_WFIKKN 455..563 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.