| Sequence 1: | NP_001036330.1 | Gene: | Acp24A4 / 318936 | FlyBaseID: | FBgn0051779 | Length: | 78 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_066925.1 | Gene: | SPINT2 / 10653 | HGNCID: | 11247 | Length: | 252 | Species: | Homo sapiens |
| Alignment Length: | 47 | Identity: | 25/47 - (53%) |
|---|---|---|---|
| Similarity: | 33/47 - (70%) | Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 AANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Acp24A4 | NP_001036330.1 | Kunitz-type | 25..76 | CDD:438633 | 24/45 (53%) |
| SPINT2 | NP_066925.1 | Kunitz_HAI2_1-like | 36..88 | CDD:438664 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 100..122 | ||||
| Kunitz_HAI2_2-like | 131..183 | CDD:438665 | 24/45 (53%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||