DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and EPPIN-WFDC6

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001185915.1 Gene:EPPIN-WFDC6 / 100526773 HGNCID:38825 Length:179 Species:Homo sapiens


Alignment Length:59 Identity:29/59 - (49%)
Similarity:38/59 - (64%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.||.::|.:| ...|.|||.|..|.||.:.|.|..|:|||||||.|:|:|:..|:|.|
Human    70 LDLKQDVCEMP-KETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTC 127

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 26/53 (49%)