DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31775 and CG42586

DIOPT Version :9

Sequence 1:NP_001162976.1 Gene:CG31775 / 318935 FlyBaseID:FBgn0028537 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001162978.1 Gene:CG42586 / 8673977 FlyBaseID:FBgn0260954 Length:89 Species:Drosophila melanogaster


Alignment Length:89 Identity:89/89 - (100%)
Similarity:89/89 - (100%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLILFIALFAAAAALPQFGFGGGFGDQQQQQQGGFGGGFGDQQQQQGGFGGGFGGGFGDQQQQ 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MKFLILFIALFAAAAALPQFGFGGGFGDQQQQQQGGFGGGFGDQQQQQGGFGGGFGGGFGDQQQQ 65

  Fly    66 QQGGFGGGFGGGFGDQQQQQQQGW 89
            ||||||||||||||||||||||||
  Fly    66 QQGGFGGGFGGGFGDQQQQQQQGW 89



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.