DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and DLK1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_003827.4 Gene:DLK1 / 8788 HGNCID:2907 Length:383 Species:Homo sapiens


Alignment Length:472 Identity:103/472 - (21%)
Similarity:150/472 - (31%) Gaps:179/472 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EKLFGKLLLLLAM--------VLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGP-GNICIREEP 59
            |.|...||||||.        ..|..:.||...: :.||...:      |..||| .:.|:    
Human     5 EALLRVLLLLLAFGHSTYGAECFPACNPQNGFCE-DDNVCRCQ------PGWQGPLCDQCV---- 58

  Fly    60 YVEHVQVPEMQPVRVRTSSWCME----IPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNL 120
                            ||..|:.    .|.:|                       .|..|::|.|
Human    59 ----------------TSPGCLHGLCGEPGQC-----------------------ICTDGWDGEL 84

  Fly   121 SD------SQATCKPICRGGCGRGSCVMPD----ICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQ 175
            .|      |.|.|       ....:||..|    .|||..||.||.| |:.|    |....|...
Human    85 CDRDVRACSSAPC-------ANNRTCVSLDDGLYECSCAPGYSGKDC-QKKD----GPCVINGSP 137

  Fly   176 CQNGAACDNKSG-----LCHCIAGWTGQFCEL-------------------------PCPQGTYG 210
            ||:|..|.:..|     .|.|..|::|.|||:                         .||.|...
Human   138 CQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFID 202

  Fly   211 IMC-RKACDCDEKPCNPQTGACIQQDQPLQLNVSHVIV---ETVNST-LEKMGIIPRPTTPVPLP 270
            ..| |...:|...||. ..|.|:|..|     ||:..:   |....| ::|..:.|:..|.:|  
Human   203 KTCSRPVTNCASSPCQ-NGGTCLQHTQ-----VSYECLCKPEFTGLTCVKKRALSPQQVTRLP-- 259

  Fly   271 EVIVIKQPTSNENAQHSPKIIVHQSSSDLLENLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFV 335
                                    |...|...|         ||.| |.:.  :..|:..:....
Human   260 ------------------------SGYGLAYRL---------TPGV-HELP--VQQPEHRILKVS 288

  Fly   336 GGEANSSQTATADHQSGLVVTLVSIMLLLLVAIAVGSLYVYR--------RYHH-----KNAAV- 386
            ..|.|.......:.|: :..|::.::..|:|...||.:::.:        ||:|     ||..: 
Human   289 MKELNKKTPLLTEGQA-ICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQ 352

  Fly   387 YNANGTVTTLPANPEVV 403
            ||:...:......||.:
Human   353 YNSGEDLAVNIIFPEKI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 7/67 (10%)
EGF_2 170..200 CDD:285248 10/34 (29%)
DLK1NP_003827.4 EGF_CA 88..125 CDD:238011 14/44 (32%)
EGF_CA 135..168 CDD:238011 10/32 (31%)
EGF_CA 175..205 CDD:238011 3/29 (10%)
EGF_CA 212..245 CDD:238011 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.