DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and MEGF10

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_016865476.1 Gene:MEGF10 / 84466 HGNCID:29634 Length:1195 Species:Homo sapiens


Alignment Length:228 Identity:75/228 - (32%)
Similarity:104/228 - (45%) Gaps:12/228 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FGKLLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPGNICIREEPYVEHVQVPEMQP 71
            |.:::|...||:.|    ||.|.....:.....|..:..:::.| |:|...|.|...||.....|
Human    47 FCRVVLQKKMVISL----NSCLSFICLLLCHWIGTASPLNLEDP-NVCSHWESYSVTVQESYPHP 106

  Fly    72 VRVRTSSWCMEIPP--RCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGG 134
            ......:.|.:|..  :|...:...|...|..:....|....||.|:    .:|...|.|.|...
Human   107 FDQIYYTSCTDILNWFKCTRHRVSYRTAYRHGEKTMYRRKSQCCPGF----YESGEMCVPHCADK 167

  Fly   135 CGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQF 199
            |..|.|:.|:.|.||.|:.|.:|:..||.|.||..|.:.|||:|||.|:..:|.|||.||:.|..
Human   168 CVHGRCIAPNTCQCEPGWGGTNCSSACDGDHWGPHCTSRCQCKNGALCNPITGACHCAAGFRGWR 232

  Fly   200 CELPCPQGTYGIMCRKACDCDE-KPCNPQTGAC 231
            ||..|.|||||..|.:.|.|.. ..|:..||.|
Human   233 CEDRCEQGTYGNDCHQRCQCQNGATCDHVTGEC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 15/65 (23%)
EGF_2 170..200 CDD:285248 15/29 (52%)
MEGF10XP_016865476.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.