Sequence 1: | NP_001285918.1 | Gene: | NimA / 318930 | FlyBaseID: | FBgn0261514 | Length: | 565 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001371957.1 | Gene: | MEGF11 / 84465 | HGNCID: | 29635 | Length: | 1140 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 71/207 - (34%) |
---|---|---|---|
Similarity: | 96/207 - (46%) | Gaps: | 22/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 GVVALPSIQG-------PGNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPP--RCA----TFK 91
Fly 92 TEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKH 156
Fly 157 CTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDE 221
Fly 222 -KPCNPQTGACI 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimA | NP_001285918.1 | EMI | 52..116 | CDD:284877 | 16/69 (23%) |
EGF_2 | 170..200 | CDD:285248 | 16/29 (55%) | ||
MEGF11 | NP_001371957.1 | EMI | 26..93 | CDD:400092 | 18/74 (24%) |
EGF_CA | 275..320 | CDD:419698 | |||
EGF_CA | 362..409 | CDD:419698 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D561378at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001631 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.820 |