DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and MEGF11

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001371957.1 Gene:MEGF11 / 84465 HGNCID:29635 Length:1140 Species:Homo sapiens


Alignment Length:207 Identity:71/207 - (34%)
Similarity:96/207 - (46%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GVVALPSIQG-------PGNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPP--RCA----TFK 91
            |::|...:|.       ..|:|...|.|...||.....|......:.|.:|..  :|.    ::|
Human     7 GLIAFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNWFKCTRHRISYK 71

  Fly    92 TEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKH 156
            |..|..:|.....:::    ||.||    .:|...|.|:|...|..|.||.||.|.||.|:.|..
Human    72 TAYRRGLRTMYRRRSQ----CCPGY----YESGDFCIPLCTEECVHGRCVSPDTCHCEPGWGGPD 128

  Fly   157 CTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDE 221
            |:..||.|.||..|.|.|||||||.|:..:|.|.|.||:.|..||..|..||:|..|:..|.|..
Human   129 CSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRH 193

  Fly   222 -KPCNPQTGACI 232
             ..|:|:.|.|:
Human   194 GASCDPRAGECL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 16/69 (23%)
EGF_2 170..200 CDD:285248 16/29 (55%)
MEGF11NP_001371957.1 EMI 26..93 CDD:400092 18/74 (24%)
EGF_CA 275..320 CDD:419698
EGF_CA 362..409 CDD:419698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.