DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Tnfaip6

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 / 84397 RGDID:621359 Length:275 Species:Rattus norvegicus


Alignment Length:83 Identity:19/83 - (22%)
Similarity:25/83 - (30%) Gaps:20/83 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DCKNLCQCQNGAACD-------NKSGLCHCIAGW-----TGQFCELPCPQG--------TYGIMC 213
            :.|.:|:.:.|....       .|.|...|.|||     .|.....|.|..        .|||..
  Rat    53 EAKAVCEYEGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRL 117

  Fly   214 RKACDCDEKPCNPQTGAC 231
            .::...|....||....|
  Rat   118 NRSERWDAYCYNPNAKEC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877
EGF_2 170..200 CDD:285248 10/41 (24%)
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592 16/74 (22%)
CUB 135..244 CDD:395345 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.