DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and dkk2

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001104679.1 Gene:dkk2 / 792404 ZFINID:ZDB-GENE-080204-14 Length:243 Species:Danio rerio


Alignment Length:237 Identity:46/237 - (19%)
Similarity:74/237 - (31%) Gaps:89/237 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLAMVLPLG--SGQNSTLKINTNVKDIE-------------AGVVALPSIQGPGNICIREEP 59
            :|.|:...:.:|  .|..|..::| ::|.:|             :|:....:|...|..|..::.
Zfish    12 MLPLIVAFVRMGETQGIESQAQVN-SIKSLEPQPAAANRSGASYSGIPKKSNIPAQGYPCSSDKE 75

  Fly    60 YV--EHVQVPEMQPVRVRTSSWCMEIPPRC-------------------------ATFKTEMREV 97
            .|  .:...|:..|.| |.|  |.....||                         ::.|:.|.|.
Zfish    76 CVVGTYCHSPQHAPSR-RLS--CRRRKKRCHRDNMCCPGNRCSNYICIPISESALSSHKSSMDEN 137

  Fly    98 MRVQ------KLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYI--- 153
            .:..      |.|.....:...:|:||:              .|.|.|       .|.|||.   
Zfish   138 NKFSIKEKNWKKNGKAHAKISLKGHEGD--------------PCLRSS-------DCSEGYCCAR 181

  Fly   154 -------------GKHCTQRCDHDRWGLDCKNLCQCQNGAAC 182
                         |:.||::......||:....|.|..|.||
Zfish   182 HFWTKICKPVLRQGEVCTKQRKKGSHGLEIFQRCDCAKGLAC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 15/96 (16%)
EGF_2 170..200 CDD:285248 5/13 (38%)
dkk2NP_001104679.1 Dickkopf_N 70..120 CDD:282549 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.