DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and megf10

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001072726.1 Gene:megf10 / 780183 XenbaseID:XB-GENE-491974 Length:1114 Species:Xenopus tropicalis


Alignment Length:195 Identity:66/195 - (33%)
Similarity:93/195 - (47%) Gaps:8/195 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GVVALPSIQGPGNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPP--RCATFKTEMREVMRVQK 102
            |..:..:::.| |:|...|.|...||.....|......:.|.:|..  :|...:...|...|..:
 Frog    20 GTTSSLNLEDP-NVCSHWESYSVTVQESYSHPYDQVYYTSCTDILNWFKCTRHRISYRTAYRRGE 83

  Fly   103 LNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWG 167
            ....|....||.|:    .:|:..|.|.|...|..|.|:.|:.|.||.|:.|.:|:..||.|.||
 Frog    84 KTMYRRKSQCCPGF----YESREMCVPHCADKCVHGRCIAPNTCQCEPGWGGPNCSSACDVDHWG 144

  Fly   168 LDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDE-KPCNPQTGAC 231
            ..|.:.|||:|||.|:..:|.|||.:|:.|..||..|.|||||..|::.|.|.. ..|:..||.|
 Frog   145 PHCSSRCQCKNGALCNPITGACHCSSGYKGWRCEERCDQGTYGNDCQQKCQCQNGASCDHVTGEC 209

  Fly   232  231
             Frog   210  209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 15/65 (23%)
EGF_2 170..200 CDD:285248 14/29 (48%)
megf10NP_001072726.1 EMI 31..98 CDD:369419 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.