DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Egfem1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_006535622.1 Gene:Egfem1 / 75740 MGIID:1922990 Length:658 Species:Mus musculus


Alignment Length:164 Identity:46/164 - (28%)
Similarity:62/164 - (37%) Gaps:52/164 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CCQGYEGNLSDSQATCKPICRGG-C--GRGSCVMPD-----ICS----------------CEEGY 152
            |..|..|  .|...:|:....|| |  |:..|:.|.     ||:                |.:|:
Mouse   508 CLDGTFG--LDCSLSCEDCMNGGRCQEGKSGCLCPAEWTGLICNESSVLRTGEDQQAPAGCLKGF 570

  Fly   153 IGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKAC 217
            .||             :||..|.|.|...|....|.|.|..|..|:||.|.||:|.||..|...|
Mouse   571 FGK-------------NCKRKCHCANNVHCHRVYGACMCDLGRYGRFCHLSCPRGAYGASCSLEC 622

  Fly   218 DCDEK---PCNPQTGAC----------IQQDQPL 238
            .|.|:   .|:.:.|:|          .|::.||
Mouse   623 QCVEENTLECSAKNGSCTCKSGYQGNRCQEELPL 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 1/3 (33%)
EGF_2 170..200 CDD:285248 11/29 (38%)
Egfem1XP_006535622.1 EMI 71..140 CDD:369419
FXa_inhibition 190..225 CDD:373209
vWFA <213..265 CDD:381780
vWFA <268..310 CDD:381780
vWFA <308..350 CDD:381780
FXa_inhibition 363..398 CDD:373209
vWFA <395..436 CDD:381780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.