DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Pear1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001027585.1 Gene:Pear1 / 73182 MGIID:1920432 Length:1034 Species:Mus musculus


Alignment Length:228 Identity:71/228 - (31%)
Similarity:101/228 - (44%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPGNICIREEPYVEHVQVPEMQPVRVR 75
            |||||:.|.|      |..:|:|                ..|:|...|.:....:...::|..:.
Mouse     6 LLLLALGLRL------TGTLNSN----------------DPNVCTFWESFTTTTKESHLRPFSLL 48

  Fly    76 TSSWC---MEIPPRCA----TFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRG 133
            .:..|   .|.|..||    .::|..|:|:::....:.:    ||:||    .:|:..|.|:|..
Mouse    49 PAESCHRPWEDPHTCAQPTVVYRTVYRQVVKMDSRPRLQ----CCRGY----YESRGACVPLCAQ 105

  Fly   134 GCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQ 198
            .|..|.||.|:.|.|..|:.|..|:..|....||..|...|.|.|.::||.|||.|.|.:|....
Mouse   106 ECVHGRCVAPNQCQCAPGWRGGDCSSECAPGMWGPQCDKFCHCGNNSSCDPKSGTCFCPSGLQPP 170

  Fly   199 FCELPCPQGTYGIMCRKACDCDEKPCNPQTGAC 231
            .|..|||.|.||..|:..|.|....|:||.|||
Mouse   171 NCLQPCPAGHYGPACQFDCQCYGASCDPQDGAC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 14/70 (20%)
EGF_2 170..200 CDD:285248 12/29 (41%)
Pear1NP_001027585.1 EMI 25..93 CDD:284877 16/75 (21%)
EGF_CA 535..580 CDD:304395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 823..883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 925..1034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.