DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and pear1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_700533.4 Gene:pear1 / 571812 ZFINID:ZDB-GENE-091230-1 Length:1020 Species:Danio rerio


Alignment Length:190 Identity:69/190 - (36%)
Similarity:93/190 - (48%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPP----RCA----TFKTEMREVMRVQKLNKTRT 108
            |:|...|.:...|:....||....:...|.|  |    :|.    |:||..|:|:::....:.: 
Zfish    29 NVCSLWESFTTSVKESYAQPFDQMSEEPCSE--PWSANKCTRHRITYKTLYRQVVKMDYRRRYQ- 90

  Fly   109 VRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL 173
               ||.|:    .:|:..|.|.|...|..|.||.||.|.||.|:.|..|:..||...||..|:.|
Zfish    91 ---CCPGF----YESRNKCVPRCTKECVHGRCVAPDRCQCEMGWRGDDCSSSCDGQHWGPGCRRL 148

  Fly   174 CQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDEKP-CNPQTGACI 232
            |:||||..||..:|.|.|.||:|||.|..|||...:|..||:.|.|.... ||..||.|:
Zfish   149 CECQNGGECDVLTGNCQCPAGYTGQHCHDPCPVKWFGQGCRQECQCGTGGICNQTTGECV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 17/71 (24%)
EGF_2 170..200 CDD:285248 17/29 (59%)
pear1XP_700533.4 EMI 29..96 CDD:284877 18/76 (24%)
Laminin_EGF 411..451 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.