DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and megf11

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_009291879.1 Gene:megf11 / 563468 ZFINID:ZDB-GENE-060503-252 Length:1114 Species:Danio rerio


Alignment Length:216 Identity:71/216 - (32%)
Similarity:96/216 - (44%) Gaps:28/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEAGVVALPSIQGPG-------------NICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPP--R 86
            :.|..:|||.:...|             |:|...|.|...||.....|......:.|.:|..  :
Zfish     4 VRAYPLALPVLAVLGLIISAWSLNPDDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNWFK 68

  Fly    87 CATFKTEMREVMR--VQKLNKTRTVRFCCQGY--EGNLSDSQATCKPICRGGCGRGSCVMPDICS 147
            |...:|..:...|  |:.:.:.|:.  ||.||  .|:|      |.|.|...|..|.||.||.|.
Zfish    69 CTRHRTSYKTAYRRGVRTMYRRRSQ--CCPGYFESGDL------CVPRCSEECAHGRCVSPDTCQ 125

  Fly   148 CEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIM 212
            ||.|:.|..|:..|:...||..|.|.|||:|||.|:..:|.|.|..|:.|..||..|..|.||..
Zfish   126 CEPGWGGLDCSSGCESGYWGPHCSNRCQCKNGALCNPITGACVCTDGYQGWRCEDLCEPGYYGKG 190

  Fly   213 CRKACDC-DEKPCNPQTGACI 232
            |:..|.| :...|:.:||.||
Zfish   191 CQLQCQCLNGATCHHETGECI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 16/67 (24%)
EGF_2 170..200 CDD:285248 14/29 (48%)
megf11XP_009291879.1 EMI 32..98 CDD:311482 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.