DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and megf6b

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_009304569.1 Gene:megf6b / 557764 ZFINID:ZDB-GENE-101112-3 Length:1589 Species:Danio rerio


Alignment Length:135 Identity:50/135 - (37%)
Similarity:67/135 - (49%) Gaps:21/135 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CCQGYEGNLSDSQATCKPICRGG-----------C--GRGSC-VMPDICSCEEGYIGKHCTQRCD 162
            |..|:.|:      .|:.:|..|           |  ..|.| .....|.||.|:.|..|.|:|.
Zfish   876 CPPGWTGH------NCRKVCDAGRWGLDCESVCDCRNADGVCDAQTGRCHCEAGFTGARCDQKCP 934

  Fly   163 HDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDC-DEKPCNP 226
            ...:|..||:.|||:|.|:||:..|.|.|..||||.|||.|||||.||:.|::.|.| :...|:.
Zfish   935 AGSFGPGCKHRCQCENQASCDHVGGACTCKTGWTGTFCEKPCPQGFYGLDCQQKCVCLNGGLCDH 999

  Fly   227 QTGAC 231
            .:|.|
Zfish  1000 VSGQC 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 1/3 (33%)
EGF_2 170..200 CDD:285248 16/29 (55%)
megf6bXP_009304569.1 EMI 33..102 CDD:284877
FXa_inhibition 152..187 CDD:291342
vWFA <184..227 CDD:294047
FXa_inhibition 234..270 CDD:291342
FXa_inhibition 276..311 CDD:291342
vWFA <308..350 CDD:294047
FXa_inhibition 363..398 CDD:291342
vWFA <396..436 CDD:294047
FXa_inhibition 445..480 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.