DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dkk3

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001347186.1 Gene:Dkk3 / 50781 MGIID:1354952 Length:366 Species:Mus musculus


Alignment Length:328 Identity:70/328 - (21%)
Similarity:96/328 - (29%) Gaps:137/328 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EKLFGKLL-LLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPG----------NICIRE 57
            ::|.|.|| .|||..:|.....:.|             |...|:..||.          |...||
Mouse    19 QRLGGILLCTLLAAAVPTAPAPSPT-------------VTWTPAEPGPALNYPQEEATLNEMFRE 70

  Fly    58 -EPYVEHVQ------VPEM--QPVRVRTSSW--CMEIPPRCATFKTEMREVMRV--------QKL 103
             |..:|..|      |.||  :....:|||.  ...:||   .:..|.....||        |::
Mouse    71 VEELMEDTQHKLRSAVEEMEAEEAAAKTSSEVNLASLPP---NYHNETSTETRVGNNTVHVHQEV 132

  Fly   104 NK-----------TRTV------------------------RFCCQGYEGNLSDSQATCKPICRG 133
            :|           :.||                        |:|      ..|..:.||:| ||.
Mouse   133 HKITNNQSGQVVFSETVITSVGDEEGKRSHECIIDEDCGPTRYC------QFSSFKYTCQP-CRD 190

  Fly   134 G---CGRGS-CVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSG------- 187
            .   |.|.| |....:|:      ..||||:......|..|.|...||.|..|..:.|       
Mouse   191 QQMLCTRDSECCGDQLCA------WGHCTQKATKGGNGTICDNQRDCQPGLCCAFQRGLLFPVCT 249

  Fly   188 -------LCH-------CIAGW----TGQFCELPCPQGTYGIMCRKACDCDEKPCNPQTGACIQQ 234
                   |||       .:..|    .|.....||..|..              |.|.:.:.:..
Mouse   250 PLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCASGLL--------------CQPHSHSLVYM 300

  Fly   235 DQP 237
            .:|
Mouse   301 CKP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 23/117 (20%)
EGF_2 170..200 CDD:285248 12/54 (22%)
Dkk3NP_001347186.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.