DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dkk4

DIOPT Version :10

Sequence 1:NP_609691.6 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001102802.1 Gene:Dkk4 / 502097 RGDID:1563172 Length:221 Species:Rattus norvegicus


Alignment Length:130 Identity:31/130 - (23%)
Similarity:41/130 - (31%) Gaps:46/130 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GCGRGS-CVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL---CQ----CQNGAACDNKSGLCH 190
            |.|:|| ||....|:     :||.|....|...:...|:.:   ||    |..|..|.|  .:|.
  Rat    34 GSGKGSQCVSDKDCN-----VGKFCFALHDERSFCATCRRVRRRCQRSAMCCPGTVCVN--DVCT 91

  Fly   191 CIA-----------GWTGQFCE----LPC----PQ------------GTYGIMCRKACDCDEKPC 224
            .:.           |..|.:.|    .|.    ||            |..|..|.:..||....|
  Rat    92 AVENTRPVMDRNTDGQDGTYAEGTTKWPAEENRPQGKPSTKKSQSNKGQEGESCLRTSDCGPGLC 156

  Fly   225  224
              Rat   157  156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_609691.6 EMI 51..118 CDD:462204
Dkk4NP_001102802.1 Dkk4_Cys1 37..91 CDD:438007 16/60 (27%)
Dkk4_Cys2 128..221 CDD:438001 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.