DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and NimC3

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster


Alignment Length:250 Identity:57/250 - (22%)
Similarity:98/250 - (39%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIREKLFGKLLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPGNICIREEPYVEHVQ 65
            |:::.|:..|:|:| |.:.|                :|...:|:.:.....||.::       .|
  Fly     1 MLQQVLYPMLVLVL-MTIHL----------------VEVSSLAITNGHCQKNISVK-------YQ 41

  Fly    66 VPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPI 130
            || :...|:..:.     ||. |:...::...:..::..:...::.||.||...|.   ..|:|:
  Fly    42 VP-VAKTRMAGAG-----PPN-ASHPIDLDSYVVYEERVRWDNIQVCCPGYRTILF---GFCEPV 96

  Fly   131 CRGGCGRGS-CVMPDICSCEEGYIGKHCTQRCDHDRWG--LDCKNLCQCQNGAACDNKSGLCHCI 192
            |:..|...| |..||.|.|:.||...|      |...|  |.|:.:||    ..|...|   ||:
  Fly    97 CQEACPAHSYCAEPDRCHCQRGYEPSH------HHTTGHQLICRPVCQ----GGCPEHS---HCV 148

  Fly   193 AGWTGQFCELPCPQG--------TYGIMCRKACDCDEKPCNPQTGACIQQDQPLQ 239
            |   ...||  |..|        :..:.|.:.....|:..:|...||:|.:..::
  Fly   149 A---HNECE--CWPGFKDASSWFSLSLRCERVQCGHEQRFDPGRRACVQIEMSME 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 11/63 (17%)
EGF_2 170..200 CDD:285248 8/29 (28%)
NimC3NP_524928.2 MSC 85..>212 CDD:286487 36/134 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.