DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and CG17147

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:197 Identity:44/197 - (22%)
Similarity:66/197 - (33%) Gaps:73/197 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EMREVMRV----QKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYI 153
            |..|:.|:    .|:.|..|.....|.|:||  .:..||.........:||||  |..:..    
  Fly    27 EYEELCRLFKNGTKVRKPGTCDQYIQCYDGN--GTVLTCPSNQSFNPSKGSCV--DTLANS---- 83

  Fly   154 GKHCTQRCDHDRWGLD---------CKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTY 209
            .|:|..||:    |||         |.....|.||...   :|:|.     .||..:.......|
  Fly    84 NKYCGNRCE----GLDGEWVADPTECHKYFYCMNGVPL---AGMCP-----VGQHFDERSQSCLY 136

  Fly   210 GI--MC------------------RKAC----DCDE------KPC----------NPQTGACIQQ 234
            |:  ||                  .|.|    :||:      |.|          :.::|.|::.
  Fly   137 GVDSMCVDVNNICELVAENTKFRNEKDCAYYYECDKTGNHASKSCTVTSKKREYFDVESGNCVEA 201

  Fly   235 DQ 236
            ::
  Fly   202 NK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 7/26 (27%)
EGF_2 170..200 CDD:285248 8/29 (28%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 9/34 (26%)
ChtBD2 89..136 CDD:214696 13/58 (22%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.