DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and drpr

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:233 Identity:75/233 - (32%)
Similarity:109/233 - (46%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LPSIQGPGNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRVQKLNKTRT 108
            |..:.|| |||.|.|.|...|...|:|..:.|.|:||:..||||:|::.:.|.|.:.:.:.|.|.
  Fly    20 LKDLDGP-NICKRRELYNVDVVYTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKTIAKNRI 83

  Fly   109 VRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGY-------------IGKHCTQR 160
            ||.||.||..    |...|.|.|...|..|.|:.|:.|.|:.||             .|::|:.:
  Fly    84 VRDCCDGYIA----SAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDINCPPGWYGRNCSMQ 144

  Fly   161 CD------------------------------HDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGW 195
            ||                              ...:|.:|...|:|:||..|.:.||.|.|..|:
  Fly   145 CDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGECQCAPGF 209

  Fly   196 TGQFCELPCPQGTYGIMCRKACDC-DEKPCNPQTGACI 232
            ||..|::.||.|.:|..|::.|.| ::..|.|:||||:
  Fly   210 TGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 26/63 (41%)
EGF_2 170..200 CDD:285248 13/29 (45%)
drprNP_001261276.1 EMI 27..92 CDD:284877 27/64 (42%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.