DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Scarf1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001004157.2 Gene:Scarf1 / 380713 MGIID:2449455 Length:820 Species:Mus musculus


Alignment Length:171 Identity:51/171 - (29%)
Similarity:65/171 - (38%) Gaps:53/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CCQGYEGNLSDSQATCKPICRG--GCGRGS-CVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL 173
            ||.|:  ...|.:.|. |||.|  .|.:.. ||.|.:|.|:.|:.|..|:.||....||.||:..
Mouse    44 CCPGW--RQKDQECTI-PICEGPDACRKEEVCVKPGLCRCKPGFFGAQCSSRCPGQYWGHDCRET 105

  Fly   174 ---------------CQCQNG---------------AACDNKSGLCHCIAGWTGQFCELP----- 203
                           ||||..               ..||.|:|||||..||....|..|     
Mouse   106 CPCHPRGQCEPATGDCQCQPNYWGRLCEFPCTCGPHGQCDPKTGLCHCDPGWWSPTCRRPCQCNP 170

  Fly   204 ------------CPQGTYGIMCRKACDCDEKPCNPQTGACI 232
                        ||.|.:|..|..:|:|...||...:|.|:
Mouse   171 ASRCDQATGTCVCPPGWWGRRCSFSCNCHTSPCMQDSGRCV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 2/3 (67%)
EGF_2 170..200 CDD:285248 15/59 (25%)
Scarf1NP_001004157.2 PHA03247 <541..781 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 549..685
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..820
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.