DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and NimC4

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster


Alignment Length:404 Identity:98/404 - (24%)
Similarity:148/404 - (36%) Gaps:95/404 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VKDIEAGVVALPSIQGPG---NICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTE-M 94
            :|.|.|.::.|.||....   |.|.|.|.....|.|.:.:.:..:.|.|.:       ..||| :
  Fly     1 MKFIWALILVLGSIAANAERDNYCERNETIRATVPVTKQRIIVKQPSKWKI-------WKKTEKI 58

  Fly    95 REVMRVQKLNKT-RTVRFCCQGYEGNLSDSQATCKPICRGGC-GRGSCVMPDICSCEEGYIGKHC 157
            .|:...::...| |.||.||.||   |......|:|||..|| ...||..||.|.|..||:....
  Fly    59 TEIYDSEEEQVTHRLVRECCPGY---LQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARN 120

  Fly   158 TQRCDHDRWGLDCKNLCQ--CQNGAACDNKSGLCHCIAGWTGQFCEL-PCPQGTYG---IMCR-- 214
            .|...|     .|:.:|:  |..||.|...: .|.|..|:|    :| |...|..|   .:||  
  Fly   121 HQDGSH-----YCEPICETPCPAGAQCVTPN-TCACRDGYT----QLQPTDDGVSGGCAPVCRVG 175

  Fly   215 ------KACDCDEKPCNPQTGACIQQDQPLQL---NVSHVIVETVNSTLEKMGIIPRPTTPVPLP 270
                  |..|.|...||........:::.::|   ::|..:..|.::|...........|....|
  Fly   176 DGCANGKCIDVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTATHCP 240

  Fly   271 EVIVI-------KQPTSNENAQHSPKIIVHQSSSDLLENLHTAAAAGVPTPEVIHVITNGITSPQ 328
            :..|:       ||..||:..........||:..|                       :|:....
  Fly   241 DDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLD-----------------------SGVCQCS 282

  Fly   329 EHLAGFV---GGEAN---SSQTATADHQSGLVVTL-----VSIMLLLLVAIAVGSLYVY------ 376
            :   |:|   .|||.   |.:....|...||...:     ::...:.::.:|.|.|:|.      
  Fly   283 D---GYVPEESGEATGVLSCRRTLLDQILGLNEAIDDDDELNPWTIPIIGVACGFLFVLLIVGLL 344

  Fly   377 --RRYHHKNAAVYN 388
              |||..:.||:.|
  Fly   345 GGRRYRQERAALAN 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 18/65 (28%)
EGF_2 170..200 CDD:285248 10/31 (32%)
NimC4NP_609698.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.